| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF2AK1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EIF2AK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF2AK1. This antibody reacts with human. The EIF2AK1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to EIF2AK1(eukaryotic translation initiation factor 2-alpha kinase 1) The peptide sequence was selected from the N terminal of EIF2AK1. Peptide sequence TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE. |
|---|
| Other Names | EC 2.7.11, eukaryotic translation initiation factor 2-alpha kinase 1, HCR, heme sensitive initiation factor 2a kinase, Heme-controlled repressor, Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase, Heme-regulated inhibitor, heme-regulated initiation factor 2-alpha kinase, heme-regulated repressor, Hemin-sensitive initiation factor 2-alpha kinase, HRIEC 2.7.11.1, KIAA1369heme regulated initiation factor 2 alpha kinase |
|---|
| Gene, Accession # | EIF2AK1, Gene ID: 27102, Accession: Q9BQI3, SwissProt: Q9BQI3 |
|---|
| Catalog # | NBP1-56484-20ul |
|---|
| Price | |
|---|
| Order / More Info | EIF2AK1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|