| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCB6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABCB6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCB6. This antibody reacts with human. The ABCB6 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ABCB6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYADGRETLQD |
|---|
| Other Names | ABC, ATP-binding cassette, sub-family B (MDR/TAP), member 6, EC 3.6.3, EST45597, FLJ22414, mitochondrial, Mitochondrial ABC transporter 3, MTABC3ABC14, P-glycoprotein-related protein, PRP, UMAT |
|---|
| Gene, Accession # | ABCB6, Gene ID: 10058 |
|---|
| Catalog # | NBP2-58327 |
|---|
| Price | |
|---|
| Order / More Info | ABCB6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|