| Edit |   |
| Antigenic Specificity | NFKB2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 96%, rat 96%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein., Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human NFKB2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQP |
| Other Names | nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), LYT-10, NF-kB2, p105, p52 |
| Gene, Accession # | Gene ID: 4791, UniProt: Q00653, ENSG00000077150 |
| Catalog # | HPA023900 |
| Price | |
| Order / More Info | NFKB2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |