| 产品详情 |
| Edit |   |
| Antigenic Specificity | EPLIN |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EPLIN Antibody from Novus Biologicals is a rabbit polyclonal antibody to EPLIN. This antibody reacts with human. The EPLIN Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EPLIN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RPHKDLWASKNENEEILERPAQLANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGI |
| Other Names | 1110021C24Rik, Epithelial protein lost in neoplasm, EPLINepithelial protein lost in neoplasm beta, FLJ38853, LIM domain and actin binding 1, MGC131726, SREBP3LIM domain and actin-binding protein 1, sterol regulatory element binding protein 3 |
| Gene, Accession # | LIMA1, Gene ID: 51474, Accession: Q9UHB6, SwissProt: Q9UHB6 |
| Catalog # | NBP2-38673 |
| Price | |
| Order / More Info | EPLIN Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|