| Edit |   |
| Antigenic Specificity | Epithelial Stromal Interaction 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Epithelial Stromal Interaction 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Epithelial Stromal Interaction 1. This antibody reacts with human. The Epithelial Stromal Interaction 1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to EPSTI1(epithelial stromal interaction 1 (breast)) The peptide sequence was selected form the N terminal of EPSTI1. Peptide sequence RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK. |
| Other Names | BRESI1, EC 3.1.4.16, EC 3.6.3.6, epithelial stromal interaction 1 (breast), epithelial-stromal interaction protein 1, MGC29634 |
| Gene, Accession # | EPSTI1, Gene ID: 94240, Accession: Q96J88, SwissProt: Q96J88 |
| Catalog # | NBP1-62209 |
| Price | |
| Order / More Info | Epithelial Stromal Interaction 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |