| Edit |   |
|---|
| Antigenic Specificity | Epithelial Stromal Interaction 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Epithelial Stromal Interaction 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Epithelial Stromal Interaction 1. This antibody reacts with human. The Epithelial Stromal Interaction 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to EPSTI1(epithelial stromal interaction 1 (breast)) The peptide sequence was selected from the N terminal of Epithelial Stromal Interaction 1. Peptide sequence RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK. |
|---|
| Other Names | BRESI1, EC 3.1.4.16, EC 3.6.3.6, epithelial stromal interaction 1 (breast), epithelial-stromal interaction protein 1, MGC29634 |
|---|
| Gene, Accession # | EPSTI1, Gene ID: 94240, Accession: Q96J88, SwissProt: Q96J88 |
|---|
| Catalog # | NBP1-69247 |
|---|
| Price | |
|---|
| Order / More Info | Epithelial Stromal Interaction 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|