| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Epithelial Stromal Interaction 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Epithelial Stromal Interaction 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Epithelial Stromal Interaction 1. This antibody reacts with human, mouse. The Epithelial Stromal Interaction 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human Epithelial Stromal Interaction 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW |
|---|
| Other Names | BRESI1, EC 3.1.4.16, EC 3.6.3.6, epithelial stromal interaction 1 (breast), epithelial-stromal interaction protein 1, MGC29634 |
|---|
| Gene, Accession # | EPSTI1, Gene ID: 94240 |
|---|
| Catalog # | NBP1-89940 |
|---|
| Price | |
|---|
| Order / More Info | Epithelial Stromal Interaction 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24096480 |
|---|
| 产品资料 |
|
|