产品详情 |
Edit |   |
Antigenic Specificity | MUC16 |
Clone | CBXC-0679 |
Host Species | Recombinant Mouse |
Reactive Species | human |
Isotype | IgG2b |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | IHC-P |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse Anti-MUC16 Recombinant Antibody (CBXC-0679). This product is a mouse antibody that recognizes MUC16. The antibody CBXC-0679 can be used for immunoassay techniques such as: IHC-P. This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich |
Immunogen | Recombinant protein corresponding to the following amino acid sequence:GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ |
Other Names | Mucin 16, Cell Surface Associated; Ovarian Cancer-Related Tumor Marker CA125; Ovarian Carcinoma Antigen CA125; CA125; CA125 Ovarian Cancer Antigen; Mucin-16; CA-125; MUC-16; |
Gene, Accession # | Gene ID: 94025, UniProt: Q8WXI7 |
Catalog # | CBMAB-C5566-CQ |
Price | |
Order / More Info | MUC16 Antibody from CREATIVE BIOLABS |
Product Specific References | n/a |
产品资料 |
|
|