| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Carbonic Anhydrase X/CA10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Carbonic Anhydrase X/CA10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Carbonic Anhydrase X/CA10. This antibody reacts with human. The Carbonic Anhydrase X/CA10 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Carbonic Anhydrase X/CA10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
|---|
| Other Names | carbonic anhydrase X, carbonic anhydrase-related protein 10, Carbonic anhydrase-related protein X, CARP X, CA-RPX, CARPXCA-RP X, Cerebral protein 15, cerebral protein-15, HUCEP-15 |
|---|
| Gene, Accession # | CA10, Gene ID: 56934 |
|---|
| Catalog # | NBP2-55638 |
|---|
| Price | |
|---|
| Order / More Info | Carbonic Anhydrase X/CA10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|