| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Perilipin 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Perilipin 3 Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids. |
|---|
| Other Names | perilipin-3 isoform 2; Perilipin-3; perilipin-3; perilipin 3; 47 kDa mannose 6-phosphate receptor-binding protein; 47 kDa MPR-binding protein; Cargo selection protein TIP47; Mannose-6-phosphate receptor-binding protein 1; Placental protein 17; PP17, PLIN3; PLIN3; PP17; TIP47; M6PRBP1; M6PRBP1; TIP47; 47 kDa MPR-binding protein; PP17 |
|---|
| Gene, Accession # | PLIN3, Gene ID: 10226, NCBI: NP_001157661.1, UniProt: O60664 |
|---|
| Catalog # | MBS178513 |
|---|
| Price | |
|---|
| Order / More Info | Perilipin 3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: M6PRBP1 mannose-6-phosphate receptor binding protein 1. 2. Bulankina AV, Deggerich A, Wenzel D, Mutenda K, Wittmann JG, Rudolph MG, Burger KN, Honing S (May 2009).TIP47 functions in the biogenesis of lipid droplets. J. Cell Biol. 185 (4): 641-55. 3. Carroll KS, Hanna J, Simon I, Krise J, Barbero P, Pfeffer SR. (May 2001). Role of Rab9 GTPase in facilitating receptor recruitment by TIP47.. Science 292(5520): 1373-6. |
|---|
| 产品资料 |
|
|