| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRPV5 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-TRPV5 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.Ig Type: Rabbit IgG |
|---|
| Other Names | transient receptor potential cation channel subfamily V member 5; Transient receptor potential cation channel subfamily V member 5; transient receptor potential cation channel subfamily V member 5; transient receptor potential cation channel subfamily V member 5; Calcium transport protein 2; CaT2; Epithelial calcium channel 1; ECaC; ECaC1; Osm-9-like TRP channel 3; OTRPC3, TRPV5; TRPV5; CAT2; ECAC1; OTRPC3; ECAC1; TrpV5; CaT2; ECaC; ECaC1; OTRPC3 |
|---|
| Gene, Accession # | TRPV5, Gene ID: 56302, NCBI: NP_062815.3, UniProt: Q9NQA5 |
|---|
| Catalog # | MBS178072 |
|---|
| Price | |
|---|
| Order / More Info | TRPV5 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Clapham DE, Julius D, Montell C, Schultz G (Dec 2005). International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.Pharmacol. Rev. 57 (4): 427-50. 2. Muller D, Hoenderop JG, Meij IC, van den Heuvel LP, Knoers NV, den Hollander AI et al. (Nov 2000). Molecular cloning, tissue distribution, and chromosomal mapping of the human epithelial Ca2 channel (ECAC1). Genomics 67 (1): 48-53. 3. Muller D, Hoenderop JG, Merkx GF, |
|---|
| 产品资料 |
|
|