| 产品详情 |
| Edit |   |
| Antigenic Specificity | NHE1/SLC9A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NHE1/SLC9A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHE1/SLC9A1. This antibody reacts with human. The NHE1/SLC9A1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SLC9A1(solute carrier family 9 (sodium/hydrogen exchanger), member 1) The peptide sequence was selected form the middle region of SLC9A1. Peptide sequence RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG. |
| Other Names | APNH1, APNHFLJ42224, Na(+)/H(+) antiporter, amiloride-sensitive, Na(+)/H(+) exchanger 1, Na+/H+, amiloride sensitive), Na-Li countertransporter, NHE-1, NHE1Na+/H+ antiporter, amiloride-sensitive, sodium/hydrogen exchanger 1, solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, solute carrier family 9 (sodium/hydrogen exchanger), member 1, solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Solute carrier family 9 member 1 |
| Gene, Accession # | SLC9A1, Gene ID: 6548 |
| Catalog # | NBP1-62408 |
| Price | |
| Order / More Info | NHE1/SLC9A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|