| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAM32 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAM32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAM32. This antibody reacts with human. The ADAM32 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ADAM32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LDARCESVFGKGSRNAPFACYEEIQSQSDRFGNCGRDRNNKYVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAF |
|---|
| Other Names | a disintegrin and metalloprotease domain 32, a disintegrin and metalloproteinase domain 32, ADAM 32, ADAM metallopeptidase domain 32, disintegrin and metalloproteinase domain-containing protein 32, FLJ26299, FLJ29004, metalloproteinase 12-like protein |
|---|
| Gene, Accession # | ADAM32, Gene ID: 203102 |
|---|
| Catalog # | NBP2-55758 |
|---|
| Price | |
|---|
| Order / More Info | ADAM32 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|