| Edit |   |
|---|
| Antigenic Specificity | ADAM30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAM30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAM30. This antibody reacts with human. The ADAM30 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ADAM30(ADAM metallopeptidase domain 30) The peptide sequence was selected from the N terminal of ADAM30. Peptide sequence IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH. |
|---|
| Other Names | a disintegrin and metalloproteinase domain 30, ADAM 30, ADAM metallopeptidase domain 30, disintegrin and metalloproteinase domain-containing protein 30, EC 3.4.24.-, svph4 |
|---|
| Gene, Accession # | ADAM30, Gene ID: 11085, Accession: Q9UKF2, SwissProt: Q9UKF2 |
|---|
| Catalog # | NBP1-62430 |
|---|
| Price | |
|---|
| Order / More Info | ADAM30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|