| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BRUNOL6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BRUNOL6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRUNOL6. This antibody reacts with human. The BRUNOL6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to BRUNOL6(bruno-like 6, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL6. Peptide sequence QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP. |
|---|
| Other Names | Bruno (Drosophila) -like 6, RNA binding protein, Bruno -like 6, RNA binding protein, BRUNOL6bruno-like 6, RNA binding protein (Drosophila), bruno-like 6, RNA binding protein, Bruno-like protein 6, CELF-6, CUG-BP and ETR-3 like factor 6, CUG-BP- and ETR-3-like factor 6, CUGBP Elav-like family member 6, CUGBP, Elav-like family member 6, RNA-binding protein BRUNOL-6 |
|---|
| Gene, Accession # | CELF6, Gene ID: 60677, Accession: Q96J87, SwissProt: Q96J87 |
|---|
| Catalog # | NBP1-57256 |
|---|
| Price | |
|---|
| Order / More Info | BRUNOL6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|