| 产品详情 |
| Edit |   |
| Antigenic Specificity | BRUNOL6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BRUNOL6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRUNOL6. This antibody reacts with human. The BRUNOL6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BRUNOL6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLS |
| Other Names | Bruno (Drosophila) -like 6, RNA binding protein, Bruno -like 6, RNA binding protein, BRUNOL6bruno-like 6, RNA binding protein (Drosophila), bruno-like 6, RNA binding protein, Bruno-like protein 6, CELF-6, CUG-BP and ETR-3 like factor 6, CUG-BP- and ETR-3-like factor 6, CUGBP Elav-like family member 6, CUGBP, Elav-like family member 6, RNA-binding protein BRUNOL-6 |
| Gene, Accession # | CELF6, Gene ID: 60677, Accession: Q96J87, SwissProt: Q96J87 |
| Catalog # | NBP2-32050 |
| Price | |
| Order / More Info | BRUNOL6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|