| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD48/SLAMF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD48/SLAMF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD48/SLAMF2. This antibody reacts with human. The CD48/SLAMF2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CD48/SLAMF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV |
|---|
| Other Names | BCM1 surface antigen, BCM1Leukocyte antigen MEM-102, BLAST, BLAST1TCT.1, B-lymphocyte activation marker BLAST-1, CD48 antigen, CD48 antigen (B-cell membrane protein), CD48 molecule, hCD48, mCD48, MEM-102, SLAMF2 |
|---|
| Gene, Accession # | CD48, Gene ID: 962 |
|---|
| Catalog # | NBP2-55445 |
|---|
| Price | |
|---|
| Order / More Info | CD48/SLAMF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|