| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Aldehyde Dehydrogenase 3-A1/ALDH3A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aldehyde Dehydrogenase 3-A1/ALDH3A1. This antibody reacts with human. The Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Aldehyde Dehydrogenase 3-A1/ALDH3A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL |
|---|
| Other Names | Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC 1.2.1.5, MGC10406, stomach aldehyde dehydrogenase |
|---|
| Gene, Accession # | ALDH3A1, Gene ID: 218 |
|---|
| Catalog # | NBP2-55797 |
|---|
| Price | |
|---|
| Order / More Info | Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|