| 产品详情 |
| Edit |   |
| Antigenic Specificity | Osteocalcin |
| Clone | 190125 |
| Host Species | Mouse |
| Reactive Species | human, rat |
| Isotype | IgG1 |
| Format | Protein A/G purified, no preservative |
| Size | 100 ug |
| Concentration | lyophilized |
| Applications | Immunohistochemistry, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Human/Rat Osteocalcin Antibody from R&D Systems is a mouse monoclonal antibody to Osteocalcin. This antibody reacts with human, rat. The Human/Rat Osteocalcin Antibody has been validated for the following applications: Immunohistochemistry, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready. Detects human Osteocalcin in direct ELISAs |
| Immunogen | Human Osteocalcin synthetic peptide, YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV, Accession # P02818 |
| Other Names | BGLAP, BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin |
| Gene, Accession # | BGLAP, Gene ID: 632, Accession: P02818 |
| Catalog # | MAB1419 |
| Price | |
| Order / More Info | Osteocalcin Antibody from R&D SYSTEMS, INC. |
| Product Specific References | PubMed: 15957205, 16735063, 21992089, 23129653, 23533608, 24384131, 24631025, 25354236, 26572489, 27076035, 27411105, 27444640, 28211493, 28323540, 28332281, 28814956, 29467014, 29514703, 30463597, 30716659, 30813947 |
| 产品资料 |
|
|