| Edit |   |
|---|
| Antigenic Specificity | CRABP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 24626200). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CRABP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CRABP1. This antibody reacts with human. The CRABP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CRABP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE |
|---|
| Other Names | cellular retinoic acid binding protein 1, CRABP, CRABPI, CRABP-Icellular retinoic acid-binding protein 1, RBP5Cellular retinoic acid-binding protein I |
|---|
| Gene, Accession # | CRABP1, Gene ID: 1381 |
|---|
| Catalog # | NBP1-84384 |
|---|
| Price | |
|---|
| Order / More Info | CRABP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24626200 |
|---|