| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NEURL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NEURL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEURL2. This antibody reacts with human. The NEURL2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NEURL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YELNVLPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGL |
|---|
| Other Names | C20orf163, chromosome 20 open reading frame 163, dJ337O18.6, FLJ30259, MGC125934, MGC125935, neuralized homolog 2 (Drosophila), neuralized-like 2, neuralized-like 2 (Drosophila), neuralized-like protein 2, OZZ, Ozz-E3 |
|---|
| Gene, Accession # | NEURL2, Gene ID: 140825 |
|---|
| Catalog # | NBP2-56809 |
|---|
| Price | |
|---|
| Order / More Info | NEURL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|