| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACOX3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in scientific literature (PMID: 25096407). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACOX3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACOX3. This antibody reacts with human, mouse. The ACOX3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACOX3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL |
|---|
| Other Names | acyl-CoA oxidase 3, pristanoyl, Branched-chain acyl-CoA oxidase, BRCACox, BRCOX, EC 1.3.3.6, peroxisomal acyl-coenzyme A oxidase 3, PRCOX, pristanoyl, Pristanoyl-CoA oxidase |
|---|
| Gene, Accession # | ACOX3, Gene ID: 8310 |
|---|
| Catalog # | NBP1-85901 |
|---|
| Price | |
|---|
| Order / More Info | ACOX3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25096407 |
|---|
| 产品资料 |
|
|