| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMC3 |
|---|
| Clone | 4C12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse IgG monoclonal Picoband™ antibody for SMC3 detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3(1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence. |
|---|
| Other Names | Structural maintenance of chromosomes protein 3; SMC protein 3; SMC-3; Basement membrane-associated chondroitin proteoglycan; Bamacan; Chondroitin sulfate proteoglycan 6; Chromosome-associated polypeptide; hCAP; SMC3; BAM; BMH; CSPG6; SMC3L1 |
|---|
| Gene, Accession # | SMC3, UniProt: Q9UQE7 |
|---|
| Catalog # | M01930-1 |
|---|
| Price | |
|---|
| Order / More Info | SMC3 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|