| 产品详情 |
| Edit |   |
| Antigenic Specificity | SMC3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat (predicted: bovine, chicken, horse, monkey, rabbit) |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband™ antibody for Structural maintenance of chromosomes protein 3(SMC3) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence. |
| Other Names | Structural maintenance of chromosomes protein 3;SMC protein 3;SMC-3;Basement membrane-associated chondroitin proteoglycan;Bamacan;Chondroitin sulfate proteoglycan 6;Chromosome-associated polypeptide;hCAP;SMC3;BAM, BMH, CSPG6, SMC3L1; |
| Gene, Accession # | SMC3, UniProt: Q9UQE7 |
| Catalog # | PB9746 |
| Price | |
| Order / More Info | SMC3 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 产品资料 |
|
|