| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Lyn |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Tyrosine-protein kinase Lyn(LYN) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Tyrosine-protein kinase Lyn is a protein that in humans is encoded in humans by the LYN gene. It is mapped to 8q12.1. Lyn is a member of the Src family of protein tyrosine kinases. In various hematopoietic cells, Lyn has emerged as a key enzyme involved in the regulation of cell activation.Lyn has been described to have an inhibitory role in myeloid lineage proliferation. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY), identical to the related mouse sequence, and different from the related rat sequence by one amino acid. |
|---|
| Other Names | Tyrosine-protein kinase Lyn;2.7.10.2;Lck/Yes-related novel protein tyrosine kinase;V-yes-1 Yamaguchi sarcoma viral related oncogene homolog;p53Lyn;p56Lyn;LYN;JTK8; |
|---|
| Gene, Accession # | LYN, UniProt: P07948 |
|---|
| Catalog # | A01424-2 |
|---|
| Price | |
|---|
| Order / More Info | Lyn Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|