| Edit |   |
|---|
| Antigenic Specificity | ACKR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 56%, rat 56%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human ACKR2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA |
|---|
| Other Names | atypical chemokine receptor 2, CCBP2, CCR10, CCR9, CMKBR9, D6 |
|---|
| Gene, Accession # | Gene ID: 1238, UniProt: O00590, ENSG00000144648 |
|---|
| Catalog # | HPA013819 |
|---|
| Price | |
|---|
| Order / More Info | ACKR2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|