| Edit |   |
|---|
| Antigenic Specificity | TVP23A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 73%, rat 71%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human TVP23A polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEIHQH |
|---|
| Other Names | trans-golgi network vesicle protein 23 homolog A (S. cerevisiae), FAM18A, YDR084C |
|---|
| Gene, Accession # | Gene ID: 780776, UniProt: A6NH52, ENSG00000166676 |
|---|
| Catalog # | HPA060582 |
|---|
| Price | |
|---|
| Order / More Info | TVP23A Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|