| Edit |   |
|---|
| Antigenic Specificity | MOSC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MOSC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MOSC1. This antibody reacts with human. The MOSC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MOSC1 (MOCO sulphurase C-terminal domain containing 1). The peptide sequence was selected from the C terminal of MOSC1. Peptide sequence WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS. |
|---|
| Other Names | FLJ22390, MARC1, mitochondrial amidoxime reducing component 1, MOCO sulphurase C-terminal domain containing 1, MOSC domain-containing protein 1, mitochondrial |
|---|
| Gene, Accession # | MARCH1, Gene ID: 64757, Accession: Q5VT66, SwissProt: Q5VT66 |
|---|
| Catalog # | NBP1-69519 |
|---|
| Price | |
|---|
| Order / More Info | MOSC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|