产品详情 |
Edit |   |
Antigenic Specificity | Nucleoporin NUP85/Pericentrin 1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The Nucleoporin NUP85/Pericentrin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nucleoporin NUP85/Pericentrin 1. This antibody reacts with human. The Nucleoporin NUP85/Pericentrin 1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Nucleoporin NUP85/Pericentrin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ |
Other Names | 85 kDa nucleoporin, FLJ12549, frount, nuclear pore complex protein Nup85, nucleoporin 85kDa, Nucleoporin Nup75, Nucleoporin Nup85, Nup75, PCNT, PCNT1, Pericentrin-1 |
Gene, Accession # | NUP85, Gene ID: 79902 |
Catalog # | NBP2-56709 |
Price | |
Order / More Info | Nucleoporin NUP85/Pericentrin 1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|