| Edit |   |
|---|
| Antigenic Specificity | CENPW |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CENPW Antibody from Novus Biologicals is a rabbit polyclonal antibody to CENPW. This antibody reacts with human. The CENPW Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C6ORF173 The peptide sequence was selected from the N terminal of C6ORF173. Peptide sequence ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV. |
|---|
| Other Names | cancer-up-regulated gene 2 protein, centromere protein W |
|---|
| Gene, Accession # | CENPW, Gene ID: 387103 |
|---|
| Catalog # | NBP1-70496 |
|---|
| Price | |
|---|
| Order / More Info | CENPW Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|