| Edit |   |
|---|
| Antigenic Specificity | Spinster Homolog 2 (Drosophila) (SPNS2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration. |
|---|
| Immunogen | SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY |
|---|
| Other Names | fi20h04|si:dkey-7b17.4|toh|wu:fi20h04|DKFZp459J1933 |
|---|
| Gene, Accession # | Gene ID: 124976 |
|---|
| Catalog # | ABIN630851 |
|---|
| Price | |
|---|
| Order / More Info | Spinster Homolog 2 (Drosophila) (SPNS2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|