| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACTN3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | Flow Cytometry, IHC, ICC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Alpha-actinin-3(ACTN3) detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human;Mouse;Rat. No cross reactivity with other proteins. Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids. |
|---|
| Other Names | Alpha-actinin-3;Alpha-actinin skeletal muscle isoform 3;F-actin cross-linking protein;ACTN3; |
|---|
| Gene, Accession # | ACTN3, UniProt: Q08043 |
|---|
| Catalog # | PB10026 |
|---|
| Price | |
|---|
| Order / More Info | ACTN3 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|