| Edit |   |
| Antigenic Specificity | Secreted phosphoprotein 1 (SPP1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SPP1 gene encodes an acidic matrix protein, mainly expressed in mineralized tissues, kidney and atherosclerotic vessels. This protein also contributes to several steps in the process of prostate carcinogenesis and metastasis. |
| Immunogen | SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQ |
| Other Names | zgc:111821|BNSP|BSPI|ETA-1|OPN|2AR|Apl-1|Bsp|Eta|OP|Opn|Opnl|Ric|Spp-1|OSP|AI463453|SPP|SPP1|Spph1|SPPase1 |
| Gene, Accession # | Gene ID: 6696 |
| Catalog # | ABIN634668 |
| Price | |
| Order / More Info | Secreted phosphoprotein 1 (SPP1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |