| Edit |   |
| Antigenic Specificity | CDKN2D |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 79%, rat 45%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human CDKN2D polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR |
| Other Names | cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), INK4D, p19 |
| Gene, Accession # | Gene ID: 1032, UniProt: P55273, ENSG00000129355 |
| Catalog # | HPA043546 |
| Price | |
| Order / More Info | CDKN2D Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |