产品详情 |
Edit |   |
Antigenic Specificity | PAC2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The PAC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAC2. This antibody reacts with human. The PAC2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PAC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQ |
Other Names | CLAST3HSPC260, HCCA3PAC-2, hepatocellular carcinoma susceptibility protein, Hepatocellular carcinoma-susceptibility protein 3, HsT1707, likely ortholog of mouse CD40 ligand-activated specific transcript 3 (Clast3), MDS003, MGC15092, PAC2HDCMC29P, proteasome (prosome, macropain) assembly chaperone 2, proteasome assembling chaperone 2, proteasome assembly chaperone 2, TNFSF5IP1CD40 ligand-activated specific transcript 3, Tumor necrosis factor superfamily member 5-induced protein 1, tumor necrosis factor superfamily, member 5-induced protein 1, x 003 protein |
Gene, Accession # | PSMG2, Gene ID: 56984, Accession: Q969U7, SwissProt: Q969U7 |
Catalog # | NBP2-30576 |
Price | |
Order / More Info | PAC2 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|