| 产品详情 |
| Edit |   |
| Antigenic Specificity | ABCC11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABCC11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCC11. This antibody reacts with human. The ABCC11 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ABCC11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NGKICENGTHSELMQKKGKYAQLIQKMHKEATSDMLQDTAKIAEKPKVESQALATSLEESLNGNAVPEHQLTQE |
| Other Names | ATP-binding cassette protein C11, ATP-binding cassette transporter MRP8, ATP-binding cassette transporter sub-family C member 11, ATP-binding cassette, sub-family C (CFTR/MRP), member 11, EWWD, MRP8ATP-binding cassette sub-family C member 11, Multidrug resistance-associated protein 8, multi-resistance protein 8, WW |
| Gene, Accession # | ABCC11, Gene ID: 85320, Accession: Q96J66, SwissProt: Q96J66 |
| Catalog # | NBP2-38193 |
| Price | |
| Order / More Info | ABCC11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|