| Edit |   |
|---|
| Antigenic Specificity | Poly(A) Polymerase beta (Testis Specific) (PAPOLB) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PAPOLB may be involved in transferase activity, polynucleotide adenylyltransferase activity, protein binding, RNA binding, nucleotide binding, ATP binding and nucleotidyltransferase activity. |
|---|
| Immunogen | PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK |
|---|
| Other Names | PAP|Paplob|Papola-ps|Papt|Plap-ps|Tpap|papolb|si:ch211-199l3.6|wu:fc43b06|wu:fp01g10|zgc:109706|PAPT|TPAP |
|---|
| Gene, Accession # | Gene ID: 56903 |
|---|
| Catalog # | ABIN633532 |
|---|
| Price | |
|---|
| Order / More Info | Poly(A) Polymerase beta (Testis Specific) (PAPOLB) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|