Edit |   |
Antigenic Specificity | Polyamine Oxidase (Exo-N4-Amino) (PAOX) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. |
Immunogen | PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL |
Other Names | pao|PAO|2410012F02Rik|AI118225|Pao|mpao1 |
Gene, Accession # | Gene ID: 196743 |
Catalog # | ABIN631501 |
Price | |
Order / More Info | Polyamine Oxidase (Exo-N4-Amino) (PAOX) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |