| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PGLYRP2/PGRP-L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PGLYRP2/PGRP-L Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGLYRP2/PGRP-L. This antibody reacts with human. The PGLYRP2/PGRP-L Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PGLYRP2/PGRP-L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP |
|---|
| Other Names | EC 3.5.1.28, peptidoglycan recognition protein 2tagl-beta, peptidoglycan recognition protein L, PGLYRPLHMFT0141, PGRP-LN-acetylmuramoyl-L-alanine amidase, PGRPLPeptidoglycan recognition protein long, tagL, tagL-alpha, TAGL-like |
|---|
| Gene, Accession # | PGLYRP2, Gene ID: 114770, Accession: Q96PD5, SwissProt: Q96PD5 |
|---|
| Catalog # | NBP2-31930 |
|---|
| Price | |
|---|
| Order / More Info | PGLYRP2/PGRP-L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|