| Edit |   |
|---|
| Antigenic Specificity | Olfactomedin 4 (OLFM4) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined. |
|---|
| Immunogen | OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
|---|
| Other Names | tiarin|GC1|GW112|OLM4|OlfD|UNQ362|bA209J19.1|hGC-1|hOLfD|Gm296|Gm913|pPD4|olfactomedin-4 |
|---|
| Gene, Accession # | Gene ID: 10562 |
|---|
| Catalog # | ABIN630153 |
|---|
| Price | |
|---|
| Order / More Info | Olfactomedin 4 (OLFM4) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|