| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | O-GlcNAcase/OGA/MGEA5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The O-GlcNAcase/OGA/MGEA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to O-GlcNAcase/OGA/MGEA5. This antibody reacts with human. The O-GlcNAcase/OGA/MGEA5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human O-GlcNAcase/OGA/MGEA5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD |
|---|
| Other Names | bifunctional protein NCOAT, FLJ11229, HEXC, hyaluronidase in meningioma, KIAA0679, MEA5FLJ23355, meningioma expressed antigen 5 (hyaluronidase), Meningioma-expressed antigen 5, NCOAT, Nuclear cytoplasmic O-GlcNAcase and acetyltransferase, OGA, O-GlcNAcase |
|---|
| Gene, Accession # | MGEA5, Gene ID: 10724 |
|---|
| Catalog # | NBP2-57562 |
|---|
| Price | |
|---|
| Order / More Info | O-GlcNAcase/OGA/MGEA5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|