| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V, collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase.Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. |
|---|
| Immunogen | MMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN |
|---|
| Other Names | SLN-1|SLN1|STR-1|Stmy1|Str1|CHDS6|MMP-3|SL-1|STMY|STMY1|STR1|MMP10|MMP3 |
|---|
| Gene, Accession # | Gene ID: 4314,403445,17392 |
|---|
| Catalog # | ABIN633867 |
|---|
| Price | |
|---|
| Order / More Info | Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|