| Edit |   |
|---|
| Antigenic Specificity | Amphiphysin (AMPH) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein. |
|---|
| Immunogen | Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA |
|---|
| Other Names | Amp|CG8604|DAMP|Damp|Dmel\\CG8604|amph|dAmph|damph|AMPH|Amph|GB16263|AMPH1|Amph1|wu:fq25h04|zgc:73193 |
|---|
| Gene, Accession # | Gene ID: 273,218038,60668 |
|---|
| Catalog # | ABIN632382 |
|---|
| Price | |
|---|
| Order / More Info | Amphiphysin (AMPH) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|