| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FATP1/SLC27A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FATP1/SLC27A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FATP1/SLC27A1. This antibody reacts with human. The FATP1/SLC27A1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAF |
|---|
| Other Names | ACSVL5FATP-1, EC 6.2.1, EC 6.2.1.-, FATP1Solute carrier family 27 member 1, FATPlong-chain fatty acid transport protein 1, Fatty acid transport protein 1, FLJ00336, MGC71751, solute carrier family 27 (fatty acid transporter), member 1 |
|---|
| Gene, Accession # | SLC27A1, Gene ID: 376497 |
|---|
| Catalog # | NBP2-69016 |
|---|
| Price | |
|---|
| Order / More Info | FATP1/SLC27A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|