| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GSK3 alpha/GSK3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for GSK3 alpha detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Glycogen synthase kinase-3 alpha is an enzyme that in humans is encoded by the GSK3A gene. This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human GSK3 alpha (QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR). |
|---|
| Other Names | Glycogen synthase kinase-3 alpha; GSK-3 alpha; Serine/threonine-protein kinase GSK3A; GSK3A |
|---|
| Gene, Accession # | GSK3A, UniProt: P49840 |
|---|
| Catalog # | A03152-2 |
|---|
| Price | |
|---|
| Order / More Info | GSK3 alpha/GSK3A Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|