| Edit |   |
|---|
| Antigenic Specificity | CNIH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CNIH Antibody from Novus Biologicals is a rabbit polyclonal antibody to CNIH. This antibody reacts with rat. The CNIH Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Cnih (cornichon homolog (Drosophila)) The peptide sequence was selected from the N terminal of Cnih. Peptide sequence AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL. |
|---|
| Other Names | CNIH1, CNILMGC117156, cornichon homolog (Drosophila), T-cell growth-associated molecule 77, TGAM77protein cornichon homolog |
|---|
| Gene, Accession # | CNIH, Gene ID: 10175, Accession: B0BNA6 |
|---|
| Catalog # | NBP1-68915 |
|---|
| Price | |
|---|
| Order / More Info | CNIH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|