| Edit |   |
|---|
| Antigenic Specificity | Chromosome 4 Open Reading Frame 20 (C4orf20) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C4ORF20 is a thiol protease which recognises and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, an ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins. |
|---|
| Immunogen | C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC |
|---|
| Other Names | C4orf20|1810047C23Rik|RGD1311161|cb891|fb05c06|fk89d04|wu:fb05c06|wu:fk89d04|zgc:64113 |
|---|
| Gene, Accession # | Gene ID: 55325 |
|---|
| Catalog # | ABIN632121 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 4 Open Reading Frame 20 (C4orf20) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|