Edit |   |
Antigenic Specificity | Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex. |
Immunogen | BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD |
Other Names | cb233|zgc:55984|wu:fa04g07|wu:fb80b08|MGC78818|BCKDK|AI327402|BCKDKD|BDK |
Gene, Accession # | Gene ID: 10295,12041,29603 |
Catalog # | ABIN632248 |
Price | |
Order / More Info | Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |