| Edit |   |
|---|
| Antigenic Specificity | Bromodomain and WD Repeat Domain Containing 1 (BRWD1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com |
|---|
| Immunogen | BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK |
|---|
| Other Names | WDR9|BRWD1|C21orf107|N143|5330419I02Rik|D530019K20Rik|G1-403-16|Wdr9|repro5 |
|---|
| Gene, Accession # | Gene ID: 54014 |
|---|
| Catalog # | ABIN631121 |
|---|
| Price | |
|---|
| Order / More Info | Bromodomain and WD Repeat Domain Containing 1 (BRWD1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|