Edit |   |
Antigenic Specificity | GLIPR1L2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The GLIPR1L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLIPR1L2. This antibody reacts with human. The GLIPR1L2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GLIPR1L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTAS |
Other Names | GLI pathogenesis-related 1 like 2, GLIPR1-like protein 2, MGC39497 |
Gene, Accession # | GLIPR1L2, Gene ID: 144321 |
Catalog # | NBP1-81091 |
Price | |
Order / More Info | GLIPR1L2 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |